Pseudomonas entomophila: PSEEN0382 Help Entry PSEEN0382         CDS       T00362                                  Symbol grxC Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism pen  Pseudomonas entomophila Brite KEGG Orthology (KO) [BR:pen00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pen03110]     PSEEN0382 (grxC) Chaperones and folding catalysts [BR:pen03110]  Protein folding catalysts   Protein disulfide isomerase    PSEEN0382 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 GST_N Glrx-like Thioredoxin_2 CLIC-like_N SH3BGR Motif Other DBs NCBI-ProteinID:  CAK13342 UniProt:  Q1IG60 LinkDB All DBs Position 405106..405360 Genome browser AA seq 84 aa AA seqDB search MKPVIVYSSDYCPYCMRAKYLLESKGVAFEEIKVDGKPQVRAEMSQKAGRTSVPQIWIGS THVGGCDDLYALERAGKLDALLAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaagcccgtcatcgtctattccagcgactactgcccctactgcatgcgcgccaagtac ctgctcgagagcaagggcgtggcgttcgaggagatcaaggtcgacggcaaaccccaggtt cgcgccgaaatgagccagaaggccgggcgcacctcggtgccgcagatctggatcggcagc acgcacgtcggtggatgcgatgacctctatgccctggagcgcgccggcaagctcgacgcg ctgctggcggcctga

DBGET integrated database retrieval system