Porphyromonas endodontalis: LA319_00215 Help Entry LA319_00215       CDS       T08002                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pend  Porphyromonas endodontalis Pathway pend00020   Citrate cycle (TCA cycle) pend00720   Other carbon fixation pathways pend01100   Metabolic pathways pend01110   Biosynthesis of secondary metabolites pend01120   Microbial metabolism in diverse environments pend01200   Carbon metabolism pend01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pend00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     LA319_00215   09102 Energy metabolism    00720 Other carbon fixation pathways     LA319_00215 Enzymes [BR:pend01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      LA319_00215 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_2 Fer4_21 Fer4_16 Fer4_9 Fer4_10 Fer4_4 LdpA_Fe-S-bd Fer4_15 Fer4_13 Fer4_17 Fer4_8 Fer4_3 Motif Other DBs NCBI-ProteinID:  UBH64655 LinkDB All DBs Position complement(54001..54231) Genome browser AA seq 76 aa AA seqDB search MAKVRGAVVVNQQRCKGCNLCVVACPTQAISLHPDHMNDKGYHYCYMSNPEACIGCTSCG MVCPDGCISVYKVTQK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcgaaagttagaggagctgttgtagtcaatcaacagcgttgtaaaggttgcaatctc tgcgttgtggcttgccctacgcaggcgattagcttgcatcccgatcacatgaatgacaag ggatatcactattgttacatgagcaatcctgaggcttgcattggctgcactagttgcggt atggtatgccccgatggttgcatctcagtgtataaagtaactcagaaataa

DBGET integrated database retrieval system