Pedobacter sp. PACM 27299: AQ505_02370 Help Entry AQ505_02370       CDS       T04140                                  Name (GenBank) preprotein translocase   KO K03116   sec-independent protein translocase protein TatA Organism pep  Pedobacter sp. PACM 27299 Pathway pep03060   Protein export pep03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:pep00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     AQ505_02370  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     AQ505_02370  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pep02044]     AQ505_02370 Secretion system [BR:pep02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    AQ505_02370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ALL04439 UniProt:  A0A0P0NBM9 LinkDB All DBs Position 560268..560474 Genome browser AA seq 68 aa AA seqDB search MLNTPILAALGGMEIAVILVIVLLLFGGKKIPELMRGLGKGIKEFKDGKDGMDDAADKVE QNRSNKPL NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgttaaacacaccaatattagccgcattaggaggcatggaaatcgccgttatccttgta attgttttattacttttcggtggtaaaaaaattccagaactaatgcgtggcttaggtaaa ggcattaaagaatttaaagacggaaaagacgggatggatgatgctgctgataaagtagaa caaaaccgcagcaacaaaccactatag

DBGET integrated database retrieval system