KEGG   Phalaenopsis equestris: 110029707
Entry
110029707         CDS       T05601                                 
Name
(RefSeq) tubby-like F-box protein 1
  KO
K19600  tubby and related proteins
Organism
peq  Phalaenopsis equestris
Brite
KEGG Orthology (KO) [BR:peq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:peq03037]
    110029707
   04990 Domain-containing proteins not elsewhere classified [BR:peq04990]
    110029707
Cilium and associated proteins [BR:peq03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   110029707
Domain-containing proteins not elsewhere classified [BR:peq04990]
 Other domain-containing proteins
  Tubby family proteins
   110029707
SSDB
Motif
Pfam: Tub F-box-like DUF3527 F-box
Other DBs
NCBI-GeneID: 110029707
NCBI-ProteinID: XP_020587787
LinkDB
Position
Unknown
AA seq 389 aa
MSRSRGFLCSFSGASIDLFGEQRRRLRDEVEAAIEPERGEEAVGESGVEENRWSRMLPEL
MEDIIGRVEASEDRWPLRKNVVSCACVCRRWREITTGMVGSTQDTGKITFPSSLKQPGPS
ELPIQCFIKRNKNNSTFYLYLSLTQTFMDKGKFLLAARRVRRGYHTEYMISLDADDLSRG
SIAYMGKLRSNFLGTKFMLYDSKPPYDGAKASNSRASRRLASKRISPQVGTGNFEIGQVT
YKFNLLKSRGPRRMLCTLHCPAGKPPPPPSAAADGQQHSSTKISKLEATSSIVLKNKSPR
WHEHLQCWCLNFHGRVTVASVKNFQLVAAADPSQTAGGGGEGAMEDDTVLLQFGKVGDDL
FTMDYREPLSAFQAFAICLSSFGTKLACE
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgtcgaggtctagagggtttctatgtagtttttcgggggcttcgattgatctatttgga
gagcagcgaaggaggctgcgtgatgaggtggaggcggcgatagagccggagagaggggag
gaagccgtcggagaatcgggggtggaggaaaaccggtggtcgcggatgcttccggagctg
atggaggatatcatagggagggtggaggcgagcgaggaccggtggcctctgcggaagaac
gtggtttcctgcgcttgtgtatgtcggaggtggagggagatcactactggaatggtcgga
tctactcaggataccgggaagatcacctttccttcatctcttaaacagccggggccgagc
gaattgcctatccagtgctttattaagaggaacaagaacaactcgacattctatctctat
ctcagtctaacccagacttttatggacaaagggaagtttctgttggcggcgcggagggtt
cggcgtggttaccacactgaatatatgatttcccttgatgcagatgatctctctcgagga
agcatagcatacatgggaaagttgagatcaaatttcctcggcacaaagttcatgctgtac
gacagcaaaccgccgtacgacggcgcgaaggcttcgaacagccgagcaagccgccgactt
gcgagcaagcgaatcagcccccaggttggcactggaaactttgagatcggccaagttaca
tacaaattcaaccttcttaaatcacgaggaccaagacgaatgctctgcactttacattgc
cctgccggaaagccgccaccaccgccatcagcagcagcagacggccaacaacacagttcg
acgaaaatctctaaactagaagcgacgagctccatcgttctcaagaacaaatctccgagg
tggcacgagcatctccaatgctggtgtttgaattttcacggacgcgtgacggttgcatcg
gttaagaatttccagttggttgctgcggcagatccaagccagactgctggaggaggagga
gaaggagccatggaggacgacacagtgttgcttcagttcggaaaggttggagatgacttg
ttcacgatggattacagagagcccctctctgctttccaggctttcgcaatctgcctctcg
agctttggaactaagttagcttgtgaatga

DBGET integrated database retrieval system