Phalaenopsis equestris: 110032061 Help Entry 110032061         CDS       T05601                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism peq  Phalaenopsis equestris Pathway peq04145   Phagosome peq04148   Efferocytosis peq04620   Toll-like receptor signaling pathway peq05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:peq00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     110032061    04148 Efferocytosis     110032061  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110032061  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     110032061  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:peq04131]     110032061   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:peq04147]     110032061    04031 GTP-binding proteins [BR:peq04031]     110032061 Membrane trafficking [BR:peq04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     110032061  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     110032061   Macropinocytosis    Ras GTPases     110032061  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     110032061 Exosome [BR:peq04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110032061   Exosomal proteins of other body fluids (saliva and urine)    110032061   Exosomal proteins of colorectal cancer cells    110032061   Exosomal proteins of bladder cancer cells    110032061 GTP-binding proteins [BR:peq04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     110032061 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  110032061 NCBI-ProteinID:  XP_020591235 LinkDB All DBs Position Unknown AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILAGTKL DLRDDNQFFIDHPGAMAISTMQGEELRKQIGALAYVECSSKTQQNVKAVFDNAIKVVLQP PKHKKKKKRRSQKGCSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcatcgagatttattaaatgtgttactgttggggatggtgccgtggggaagacc tgcatgcttatatcctacacgagcaacacattccctacggattacgtgcctactgttttt gacaacttcagtgcaaatgttgttgttgatggtaacactgttaacctaggtttatgggac actgcaggccaggaggattataatagattaagaccattgagctatcgcggagcagatgtt tttatcctggccttttctctcatcagcaaggccagctatgagaatgttgcaaagaagtgg attccagagctgaggcattatgcccctggtgttcctataattcttgctggaacaaagctt gatcttcgggatgacaaccagttctttatcgaccaccctggtgccatggctatcagtacc atgcagggagaagagcttagaaagcaaataggcgcgctcgcctacgtcgaatgcagctcg aaaactcagcagaatgtgaaggcagtcttcgataacgccattaaagtcgttcttcagccg ccaaagcacaagaagaagaagaagagaagatcacagaagggttgctccattttatga

DBGET integrated database retrieval system