Phalaenopsis equestris: 110037624 Help Entry 110037624         CDS       T05601                                  Name (RefSeq) rac-like GTP-binding protein 7   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism peq  Phalaenopsis equestris Pathway peq04145   Phagosome peq04148   Efferocytosis peq04620   Toll-like receptor signaling pathway peq05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:peq00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     110037624    04148 Efferocytosis     110037624  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110037624  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     110037624  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:peq04131]     110037624   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:peq04147]     110037624    04031 GTP-binding proteins [BR:peq04031]     110037624 Membrane trafficking [BR:peq04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     110037624  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     110037624   Macropinocytosis    Ras GTPases     110037624  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     110037624 Exosome [BR:peq04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110037624   Exosomal proteins of other body fluids (saliva and urine)    110037624   Exosomal proteins of colorectal cancer cells    110037624   Exosomal proteins of bladder cancer cells    110037624 GTP-binding proteins [BR:peq04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     110037624 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Sua5_C AAA_7 Motif Other DBs NCBI-GeneID:  110037624 NCBI-ProteinID:  XP_020597978 LinkDB All DBs Position Unknown AA seq 196 aa AA seqDB search MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISRASYENISKKWIPELRHYAPNVPILLVGTKL DLRDNKQFLIDHPGATTISTAQGEELKKMIGAAAYIECSSKTQQNVKAVFDAAIKVVLCP PKPKRKRRKQRSCLIL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgagcactgctaggtttatcaagtgtgtaactgtcggggatggtgctgtcggaaaaact tgcatgcttatctcctacaccagcaatacctttccaacggattacgtgcctactgtattt gataacttcagtgcaaacgtggtggtggatggaagcactgtgaatcttgggctctgggac acagcaggtcaagaagattacaatagactaaggcctcttagttatagaggagctgatgta ttcttactagccttctcactgatcagcagggccagctatgagaacatatccaaaaagtgg attcctgaactgaggcattatgctccaaatgtaccaattttgctggtgggaacaaaactt gatttacgtgacaacaagcaatttctgatcgaccaccctggtgctacaactatctcaact gcgcagggggaagagttgaaaaagatgattggcgctgctgcttatattgaatgtagctcc aagactcagcagaacgtgaaagctgtttttgatgctgcaatcaaagtggtattgtgccct ccaaagccaaagagaaaaaggagaaagcaaagatcttgtttaattctttag

DBGET integrated database retrieval system