Peribacillus sp. JNUCC41: JNUCC41_19810 Help Entry JNUCC41_19810     CDS       T11068                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism perj  Peribacillus sp. JNUCC41 Brite KEGG Orthology (KO) [BR:perj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:perj03032]     JNUCC41_19810    03036 Chromosome and associated proteins [BR:perj03036]     JNUCC41_19810    03400 DNA repair and recombination proteins [BR:perj03400]     JNUCC41_19810 DNA replication proteins [BR:perj03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     JNUCC41_19810 Chromosome and associated proteins [BR:perj03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     JNUCC41_19810 DNA repair and recombination proteins [BR:perj03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       JNUCC41_19810 BRITE hierarchy Other DBs NCBI-ProteinID:  QOS92811 LinkDB All DBs Position 4066700..4066942 Genome browser AA seq 80 aa AA seqDB search MSHNELTKGNAKKAVDSLFETTSNTLAKEEKIQLVGFGTFEVRERAARTGRNPQTGEEIQ IAASKVPAFKPGKELKEAVK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atctcccataatgaactaacaaaaggaaacgcgaaaaaagcagtcgattcattgtttgaa acgacctcaaatacactcgctaaagaggaaaaaatccaactagttggatttggcacattt gaagtgcgcgagcgagcagctcgaacgggtagaaacccacaaacaggagaagaaatacaa attgcagcttccaaagttcctgcttttaaaccaggtaaggaattaaaagaggctgttaaa taa

DBGET integrated database retrieval system