Peribacillus sp. JNUCC41: JNUCC41_25075 Help Entry JNUCC41_25075     CDS       T11068                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism perj  Peribacillus sp. JNUCC41 Brite KEGG Orthology (KO) [BR:perj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:perj03032]     JNUCC41_25075    03036 Chromosome and associated proteins [BR:perj03036]     JNUCC41_25075    03400 DNA repair and recombination proteins [BR:perj03400]     JNUCC41_25075 DNA replication proteins [BR:perj03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     JNUCC41_25075 Chromosome and associated proteins [BR:perj03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     JNUCC41_25075 DNA repair and recombination proteins [BR:perj03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       JNUCC41_25075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-DNA_bdg DUF2267 HU-CCDC81_euk_1 Rpf1_C DUF6927 Motif Other DBs NCBI-ProteinID:  QOS89944 LinkDB All DBs Position complement(5203527..5203799) Genome browser AA seq 90 aa AA seqDB search MNKTELINEVVTATEISKKDATKAVDAVFDTILEALKNGDKVQLIGFGNFEVRERAARKG RNPQTGDEIEIAASKVPAFKPGKALKDAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagaattaattaatgaagttgttacagcaactgaaatttctaagaaagac gctacaaaagctgttgatgctgtttttgatacaatcttagaagctctaaaaaacggtgat aaagtccaattgattggttttggtaactttgaagttcgtgaacgtgcggctcgtaaaggc cgtaacccacaaactggtgacgaaatcgaaattgcagctagtaaagtgccagctttcaaa cccggtaaagcgctgaaagatgcagtgaagtaa

DBGET integrated database retrieval system