Candidatus Sodalis pierantonius: SOPEG_0918 Help Entry SOPEG_0918        CDS       T03006                                  Symbol zapB Name (GenBank) Putative cytoplasmic protein   KO K09892   cell division protein ZapB Organism pes  Candidatus Sodalis pierantonius Brite KEGG Orthology (KO) [BR:pes00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pes03036]     SOPEG_0918 (zapB) Chromosome and associated proteins [BR:pes03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     SOPEG_0918 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Leu_zip CtIP_N Seryl_tRNA_N GIT_CC Sec10_N UPF0242 PspA_IM30 DUF3450 DUF7491 ERM_helical ADIP YabA Nuf2_DHR10-like DUF7801 HMMR_N Dynamin-like_hel_bact COG6_N Herpes_UL6 dCache_2 XRCC4_CC DUF4763 Cep57_CLD_2 V_ATPase_I DUF4795 APG6_N bZIP_2 COG3_N Mod_r NUDE_C DivIC Cnn_1N Occludin_ELL FlaC_arch bZIP_1 CASP_C Shugoshin_N Motif Other DBs NCBI-ProteinID:  AHF73329 UniProt:  W0HHX8 LinkDB All DBs Position 931504..931743 Genome browser AA seq 79 aa AA seqDB search MAFEVFEKLEAKVQQAIDTITLLQMEIEELKEKNTSLSQEVQQAQSNRESLVNENEQLKQ EQHVWQERLRGLLSKMDEV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggcatttgaagtatttgagaaactggaagcgaaagtccaacaggctattgataccatc acgcttctgcagatggaaatcgaggagctaaaagaaaagaacacgagcctgagccaggaa gtgcagcaagcgcagagcaaccgtgagtcgctggtaaatgaaaacgagcagctaaagcag gagcagcatgtgtggcaagagcgcttgcgcggcctgttgagcaaaatggatgaggtttga

DBGET integrated database retrieval system