KEGG   Peribacillus sedimenti: V1500_08390
Entry
V1500_08390       CDS       T11238                                 
Name
(GenBank) S66 peptidase family protein
  KO
K01297  muramoyltetrapeptide carboxypeptidase [EC:3.4.17.13]
Organism
pesi  Peribacillus sedimenti
Brite
KEGG Orthology (KO) [BR:pesi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pesi01002]
    V1500_08390
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pesi01011]
    V1500_08390
Enzymes [BR:pesi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.13  muramoyltetrapeptide carboxypeptidase
     V1500_08390
Peptidases and inhibitors [BR:pesi01002]
 Serine peptidases
  Family S66
   V1500_08390
Peptidoglycan biosynthesis and degradation proteins [BR:pesi01011]
 Precursor biosynthesis
  Carboxypeptidase
   V1500_08390
SSDB
Motif
Pfam: Peptidase_S66 Peptidase_S66C
Other DBs
NCBI-ProteinID: XNY93822
LinkDB
Position
1699538..1700458
AA seq 306 aa
MIVTPKRLEQGDTVGVIAPASPPDRTNVERALGFLESLGLKVKLGEHIWNKNGYLAGTDK
ERLEDLHGMFADQEVKAIFSACGGYGTARLASQMDYGLIRSNPKILWGYSDITFLHNAIH
KETGLVTFHGPMLSSDIGKGDAHPLSKKLFHQLFEPNELIYTEEFSTLEAMVEGKAEGAL
TGGNLSLLTSTLGTRFEVETNDKLLLIEDINEEPRAVDRMLNQLFMAGKLQAAAGILVGD
FNNCVPDRPQSLTLDEVLNHYIHLAGKPALRGFKIGHCSPHISVPLGVHAELDTYQKQVR
IQPGVS
NT seq 921 nt   +upstreamnt  +downstreamnt
atgattgtaacacctaaacgtttggaacagggagatacagtcggggtcatcgccccggca
agcccgccggatcgaaccaatgtggaacgggccctgggttttcttgagtccctgggtctg
aaggtaaagctgggtgaacatatttggaacaaaaacggctacctcgccggtacggataag
gagcgacttgaggacctgcatggcatgtttgccgatcaagaagtgaaagcaatattttca
gcatgcggcggatacggtacggcacgacttgcttcacaaatggattatggcctgattagg
agcaacccgaaaattttatggggctacagtgatataactttcttacataatgcgatccat
aaagaaacgggactggttacattccacggtcccatgctaagttcggacattggaaaaggg
gatgctcatccgctatcaaaaaaactgttccatcaactgtttgagccgaatgaattgatc
tataccgaggaattttctacccttgaagcaatggtggaaggaaaggcggagggagcgctg
acaggagggaatctttcgctccttaccagtacgcttggaacccggtttgaagtagaaacg
aatgataagcttctcttgatcgaagatataaatgaagagccaagggctgttgacaggatg
cttaaccagctattcatggcgggaaagcttcaggcagctgccgggattttggtaggcgat
ttcaataattgtgtccccgatcggccgcagtccctgacgcttgatgaggtgctcaaccat
tatatccatctggcaggaaaacctgctttgagaggatttaaaatcggacattgctcaccg
catatttccgttcctttgggggtccacgctgagcttgatacgtatcaaaaacaagtcagg
atacagccgggagtcagctaa

DBGET integrated database retrieval system