Peribacillus sedimenti: V1500_24010 Help Entry V1500_24010       CDS       T11238                                  Name (GenBank) 2-hydroxymuconate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism pesi  Peribacillus sedimenti Pathway pesi00362   Benzoate degradation pesi00621   Dioxin degradation pesi00622   Xylene degradation pesi01100   Metabolic pathways pesi01120   Microbial metabolism in diverse environments pesi01220   Degradation of aromatic compounds Module pesi_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:pesi00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     V1500_24010    00622 Xylene degradation     V1500_24010    00621 Dioxin degradation     V1500_24010 Enzymes [BR:pesi01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      V1500_24010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 CHMI Spectrin_SESTD1 Motif Other DBs NCBI-ProteinID:  XNY92213 LinkDB All DBs Position 4930307..4930492 Genome browser AA seq 61 aa AA seqDB search MPYVTVKMLEGRSEEQKKNLVEKVTEAVVETTGAPKDKVVVFIEEMSKNHYGVAGKRLSD E NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgccatatgtgacagtaaaaatgcttgaagggcgttctgaggaacaaaagaagaattta gttgaaaaagtgacagaagcagttgttgagacaactggtgctcccaaggataaagtagtt gtgttcattgaagaaatgtcaaaaaatcattacggtgttgcggggaaacgtttaagcgac gagtaa

DBGET integrated database retrieval system