Populus euphratica (Euphrates poplar): 105131381 Help Entry 105131381         CDS       T05872                                  Name (RefSeq) calmodulin-like protein 11   KO K02183   calmodulin Organism peu  Populus euphratica (Euphrates poplar) Pathway peu04016   MAPK signaling pathway - plant peu04070   Phosphatidylinositol signaling system peu04075   Plant hormone signal transduction peu04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:peu00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     105131381    04070 Phosphatidylinositol signaling system     105131381    04075 Plant hormone signal transduction     105131381  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     105131381  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:peu01009]     105131381   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:peu04131]     105131381    03036 Chromosome and associated proteins [BR:peu03036]     105131381   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:peu04147]     105131381 Protein phosphatases and associated proteins [BR:peu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      105131381 Membrane trafficking [BR:peu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     105131381 Chromosome and associated proteins [BR:peu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      105131381 Exosome [BR:peu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    105131381 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 SPARC_Ca_bdg EH Dockerin_1 EF_EFCAB10_C RNA_pol_Rpb4 TerB Caleosin DUF5580_M DUF7117 PA_Ig-like Motif Other DBs NCBI-GeneID:  105131381 NCBI-ProteinID:  XP_011032625 UniProt:  A0AAJ6UMT0 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MANSLTEEQIAEFREAFCLIDKDADGFITMEELATIVQSLDRRPTKEEIQDMICDVDLDG NGTLDFEEFLNVMGRKQEENVTEELKEAFKVFDRNQDGYISATELRQVMMNLGERLTEEE AEQMIREADVDGDGLVSFEEFARMMMVAF NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcaaattctctgacagaagaacagattgctgagttccgagaggccttttgcttgatc gacaaggacgcggatggtttcattacaatggaagaactggcaaccattgtccagtcattg gatagacgtcccacgaaagaagaaattcaagacatgatatgtgacgttgatcttgacgga aatgggacgttggattttgaagaattcttgaacgtcatggggagaaagcaggaggaaaat gttactgaggaactaaaagaagctttcaaagtttttgataggaaccaagacggatatatt tcggccactgagctgagacaagtgatgatgaatttgggagagagactgacggaggaagag gctgaacaaatgataagagaggcagatgtggacggtgatggtctagttagtttcgaggaa tttgcaaggatgatgatggttgctttctga

DBGET integrated database retrieval system