Populus euphratica (Euphrates poplar): 105137830 Help Entry 105137830         CDS       T05872                                  Name (RefSeq) calmodulin-7   KO K02183   calmodulin Organism peu  Populus euphratica (Euphrates poplar) Pathway peu04016   MAPK signaling pathway - plant peu04070   Phosphatidylinositol signaling system peu04075   Plant hormone signal transduction peu04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:peu00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     105137830    04070 Phosphatidylinositol signaling system     105137830    04075 Plant hormone signal transduction     105137830  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     105137830  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:peu01009]     105137830   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:peu04131]     105137830    03036 Chromosome and associated proteins [BR:peu03036]     105137830   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:peu04147]     105137830 Protein phosphatases and associated proteins [BR:peu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      105137830 Membrane trafficking [BR:peu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     105137830 Chromosome and associated proteins [BR:peu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      105137830 Exosome [BR:peu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    105137830 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 SAPC2_N UPF0154 DUF5580_M Dockerin_1 RNA_pol_Rpb4 EFhand_Ca_insen EF-hand_EFHB_C Caleosin MotA_activ FCaBP_EF-hand EF-hand_STIM1 SPEF2_C PA_Ig-like SurA_N_3 DUF6279 MecA_N Motif Other DBs NCBI-GeneID:  105137830 NCBI-ProteinID:  XP_011042023 UniProt:  A0AAJ6Y4B2 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcagctgaccgatgaccagatctccgagttcaaggaagctttcagcctcttc gataaggacggcgatggctgcattactaccaaggagcttgggactgtgatgcgttcattg ggccaaaacccaactgaggcagaactccaggacatgataaatgaggtcgatgctgatggg aatggtaccatcgacttccctgagttcctcaacctcatggcccgcaagatgaaggatact gattctgaggaggagctcaaggaagctttcagagtttttgataaggaccagaatggcttc atttctgccgctgagctgcgccatgtcatgacaaatcttggggagaagctgacagatgag gaagttgatgagatgatccgtgaggctgatgtggatggtgatggtcagatcaactacgaa gaatttgtgaaagtcatgatggccaagtga

DBGET integrated database retrieval system