Populus euphratica (Euphrates poplar): 105140903 Help Entry 105140903         CDS       T05872                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism peu  Populus euphratica (Euphrates poplar) Pathway peu04145   Phagosome peu04148   Efferocytosis peu04620   Toll-like receptor signaling pathway peu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:peu00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105140903    04148 Efferocytosis     105140903  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105140903  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105140903  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:peu04131]     105140903   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:peu04147]     105140903    04031 GTP-binding proteins [BR:peu04031]     105140903 Membrane trafficking [BR:peu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     105140903  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     105140903   Macropinocytosis    Ras GTPases     105140903  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     105140903 Exosome [BR:peu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105140903   Exosomal proteins of other body fluids (saliva and urine)    105140903   Exosomal proteins of colorectal cancer cells    105140903   Exosomal proteins of bladder cancer cells    105140903 GTP-binding proteins [BR:peu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     105140903 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  105140903 NCBI-ProteinID:  XP_011046252 UniProt:  A0AAJ6VD71 LinkDB All DBs Position Unknown AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKAVLQP LKQKKKKKRQAQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagcgcttcaagattcataaagtgtgtcactgttggtgatggtgctgttggcaagact tgcatgcttatttcctacacgagcaacactttccctacggattacgtgccaactgtgttt gacaatttcagtgcgaatgtggttgtcgatgggagcactgtcaatttagggttgtgggat actgctggccaagaagattacaatagactgaggcctttgagctataggggggcagatgtt ttcctgcttgccttctccctcattagcaaggccagctatgaaaatgttgcaaagaaatgg attcctgaattgaggcattatgcacctggtgttccaattattcttgttgggacaaagctt gatctccgagatgataaacaattctttatagatcacccaggtgcggtgcccattaccaca gctcagggagaggaactgagaaagctaataggggctcctgtatacattgagtgcagttca aaaacacagcagaatgtcaaagcggtctttgatgcagccattaaggccgtcctccagcct ctgaagcagaagaagaaaaagaagagacaggcacaaaaggcctgctccatattgtga

DBGET integrated database retrieval system