Paraburkholderia edwinii: KZJ38_06175 Help Entry KZJ38_06175       CDS       T07588                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pew  Paraburkholderia edwinii Pathway pew00998   Biosynthesis of various antibiotics pew01100   Metabolic pathways pew01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pew00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KZJ38_06175    00074 Mycolic acid biosynthesis     KZJ38_06175   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KZJ38_06175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB Raf1_N Motif Other DBs NCBI-ProteinID:  QYD69923 LinkDB All DBs Position 1:1409593..1409844 Genome browser AA seq 83 aa AA seqDB search MTDAEILARIRAIFKENFAIDPERVTPEAHLFEELDLDSIDAVDLAIKLQEMTGRRIKPE EFKSVRTVGDVIVAVESLLAAQG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgaccgacgcagaaatcctcgcgcgcattcgcgcgatcttcaaggagaacttcgccatc gatcccgaacgcgtgacgcccgaggcgcacctgttcgaggaactcgacctcgatagtatc gacgccgtcgatctggcgatcaagctgcaggaaatgacgggccgtcgcatcaagccggaa gagttcaagtcggtgcgcacggtgggcgatgtgatcgttgcggtcgaatcgctgctcgcg gcgcagggctga

DBGET integrated database retrieval system