Paraburkholderia edwinii: KZJ38_06900 Help Entry KZJ38_06900       CDS       T07588                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pew  Paraburkholderia edwinii Pathway pew00998   Biosynthesis of various antibiotics pew01100   Metabolic pathways pew01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pew00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KZJ38_06900 (acpP)    00074 Mycolic acid biosynthesis     KZJ38_06900 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KZJ38_06900 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  QYD70040 LinkDB All DBs Position 1:1567083..1567322 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgttaagaagatcgttgcggaacaactgggcgtcgccgaa gcggaaatcaagaacgaagcctcgttcgtcaacgatctcggcgctgattcgctcgatacc gtcgaactggtgatggcccttgaagacgaattcggcatggaaatcccggatgaagaagcc gagaagatcaccacggtgcagcaagcgatcgactacgctcgcgccaacgtcaaggcttaa

DBGET integrated database retrieval system