Pedobacter endophyticus: IZT61_10730 Help Entry IZT61_10730       CDS       T07452                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism pex  Pedobacter endophyticus Pathway pex00190   Oxidative phosphorylation pex01100   Metabolic pathways Module pex_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:pex00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     IZT61_10730 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pex00194]     IZT61_10730 (atpE) Photosynthesis proteins [BR:pex00194]  Photosystem and electron transport system   F-type ATPase [OT]    IZT61_10730 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C OPT Motif Other DBs NCBI-ProteinID:  QPH41688 UniProt:  A0A7S9Q0K2 LinkDB All DBs Position complement(2663749..2663958) Genome browser AA seq 69 aa AA seqDB search MTGSIAAIGAGLAVIGAGIGIGQVGGKAMEGIARQPEAAAKIQTAMIIAAALVEGVALFG VVVALLGNG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgacaggttcaatcgcggcaataggtgccggtttagcagtaattggtgccggtatcggt atcggtcaagtaggtggtaaagcaatggaaggtattgctcgtcaaccagaagctgcagca aaaattcaaacagctatgatcatcgctgcagcccttgtagaaggtgttgctttgttcggt gtggtagtagcgttgttaggtaacggttaa

DBGET integrated database retrieval system