Pantoea eucalypti: EE896_12100 Help Entry EE896_12100       CDS       T06282                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pey  Pantoea eucalypti Pathway pey01100   Metabolic pathways pey01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pey00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EE896_12100 (acpP)    00074 Mycolic acid biosynthesis     EE896_12100 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EE896_12100 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB DUF1896 HLH Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  QGF27525 LinkDB All DBs Position complement(2593271..2593507) Genome browser AA seq 78 aa AA seqDB search MSDIEQRVKKIISEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINSHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaacaacgcgttaagaaaatcatcagtgagcagctgggtgtgaaagag gaagaagtcaccaactctgcatctttcgtagaagacctgggtgccgattctcttgatacc gttgagctggtgatggctctggaagaagagtttgatactgagattccagacgaagaagct gagaaaatcactaccgttcaggcagcgatcgactatatcaatagccataaaggctaa

DBGET integrated database retrieval system