Pantoea eucalypti: EE896_12400 Help Entry EE896_12400       CDS       T06282                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pey  Pantoea eucalypti Pathway pey01100   Metabolic pathways pey01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pey00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EE896_12400    00074 Mycolic acid biosynthesis     EE896_12400   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EE896_12400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QGF27583 LinkDB All DBs Position complement(2651393..2651650) Genome browser AA seq 85 aa AA seqDB search MDSLINDIKQMIIDTLNLEDLSPDDIETDAALFGDGLGLDSIDALELGLAVKNRYRVTLS AESETLRAHFFSVATLAAFVNQQRG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggattcattaattaacgatatcaaacagatgattatcgacacgctgaaccttgaagat ctcagccctgatgatattgagactgacgctgccctgtttggcgacgggctggggctggac tcaattgatgcactggaacttggcctggcagtgaaaaatcgctaccgcgtgacgctctct gcggaaagtgaaaccctgcgtgcccacttcttctctgtcgcgacgctggccgcgttcgtc aaccaacagcgcggctga

DBGET integrated database retrieval system