Pseudomonas eucalypticola: HWQ56_06525 Help Entry HWQ56_06525       CDS       T07251                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pez  Pseudomonas eucalypticola Pathway pez01100   Metabolic pathways pez01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pez00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HWQ56_06525    00074 Mycolic acid biosynthesis     HWQ56_06525   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HWQ56_06525 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF6137 YhzD Motif Other DBs NCBI-ProteinID:  QKZ03462 UniProt:  A0A7D5H1X6 LinkDB All DBs Position complement(1422976..1423224) Genome browser AA seq 82 aa AA seqDB search MPRFGIRKTVHNFITDYIGDGDFDDDVALEDLGLDKKDIMELITRLEDEYGLTAFTSEED KLLEQAVTANDLWRFLQQITRH NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgccccggttcggtattcgcaagaccgtgcacaatttcatcaccgactacatcggcgac ggtgacttcgacgacgatgtcgcgcttgaggaccttgggctcgacaagaaagacatcatg gaactgattactcgtttagaggacgagtacgggctaactgccttcaccagcgaggaagac aagttgctggagcaggccgtgacggccaatgacctgtggcggttcctgcagcagatcacc aggcattga

DBGET integrated database retrieval system