Pseudomonas eucalypticola: HWQ56_20665 Help Entry HWQ56_20665       CDS       T07251                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pez  Pseudomonas eucalypticola Pathway pez01100   Metabolic pathways pez01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pez00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HWQ56_20665 (acpP)    00074 Mycolic acid biosynthesis     HWQ56_20665 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HWQ56_20665 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  QKZ06062 UniProt:  A0A7D5H5G4 LinkDB All DBs Position complement(4657470..4657706) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgccgagcaactgggcgttaaagaa gaagaagtggtgaacactgcttccttcgttgaagatctgggtgccgattcccttgacacc gttgagctggtgatggctctggaagaggaattcgagactgaaatccctgacgaagaagct gagaaaatcactactgttcaagccgctatcgattacgtcaccagccaccaggcttaa

DBGET integrated database retrieval system