Paenibacillus sp. E222: HW560_18465 Help Entry HW560_18465       CDS       T10443                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pezz  Paenibacillus sp. E222 Pathway pezz02024   Quorum sensing pezz03018   RNA degradation Brite KEGG Orthology (KO) [BR:pezz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     HW560_18465 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     HW560_18465 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pezz03019]     HW560_18465 (hfq)    03036 Chromosome and associated proteins [BR:pezz03036]     HW560_18465 (hfq) Messenger RNA biogenesis [BR:pezz03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      HW560_18465 (hfq) Chromosome and associated proteins [BR:pezz03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     HW560_18465 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 DUF150_C Motif Other DBs NCBI-ProteinID:  QLG39898 LinkDB All DBs Position 4080188..4080430 Genome browser AA seq 80 aa AA seqDB search MNKSINIQDTFLNQLRKENIPATVYLTNGFQIRGTIKAFDNFTIVIDSDGRQQMVYKHAI STFTPQRSVSLMQQDNSGEA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaacaagtccatcaacatccaagatacgttcttgaaccaactgcggaaagaaaacatt ccagctacggtctatctgaccaatggctttcaaatccgcggaacgatcaaggcatttgac aattttacgatcgtcattgacagcgacggacgccagcaaatggtctacaagcacgccatc tccacgttcacgccgcaacgcagcgtatcgctgatgcagcaagataatagcggcgaagct taa

DBGET integrated database retrieval system