Pseudomonas synxantha LBUM223: VO64_2765 Help Entry VO64_2765         CDS       T03769                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism pfb  Pseudomonas synxantha LBUM223 Brite KEGG Orthology (KO) [BR:pfb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pfb03036]     VO64_2765 Chromosome and associated proteins [BR:pfb03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     VO64_2765 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Filament Asd-4 ZapB VGPC1_C Macoilin TPR_MLP1_2 Motif Other DBs NCBI-ProteinID:  AKA83311 UniProt:  A0A0R2Z4R5 LinkDB All DBs Position 3082974..3083183 Genome browser AA seq 69 aa AA seqDB search MEDTDLQALMARLELLIDRVEQLKSQNGLLLAQEKTWREERAHLIEKNEIARRKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaccgacctgcaagcgctgatggccagactcgaactgctaattgatcgggtc gagcaactaaagagtcaaaacggactcctattagctcaggaaaagacctggcgcgaggaa cgcgctcacctcattgaaaaaaacgaaatcgcccggcgtaaggtcgaatcgatgatttcg cgcctgaaggccttggagcaagactcatga

DBGET integrated database retrieval system