Pseudomonas synxantha LBUM223: VO64_3417 Help Entry VO64_3417         CDS       T03769                                  Name (GenBank) Glutaredoxin 3 (Grx3)   KO K03676   glutaredoxin 3 Organism pfb  Pseudomonas synxantha LBUM223 Brite KEGG Orthology (KO) [BR:pfb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pfb03110]     VO64_3417 Chaperones and folding catalysts [BR:pfb03110]  Protein folding catalysts   Protein disulfide isomerase    VO64_3417 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Thioredoxin_2 GST_N_2 Glrx-like DSBA Thioredoxin_4 SH3BGR Motif Other DBs NCBI-ProteinID:  AKA83963 UniProt:  A0AAU8U0J5 LinkDB All DBs Position 3835924..3836178 Genome browser AA seq 84 aa AA seqDB search MSQVVVYSSDYCPYCIRAKQLLQSKKVAFEEIKVDGKPQVRAEMAQKAGRTSVPQIWIGA THIGGCDDLFALERAGKLDALLLV NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagccaggttgtcgtgtattccagcgattattgcccttattgcattcgagccaagcag ttgctccaaagcaagaaggtggccttcgaagagatcaaggtcgatggcaagccccaggtg cgcgccgaaatggcccagaaggccggccgcacgtcggtcccgcagatctggatcggcgcc acgcacatcggtggttgcgatgacctgttcgccctggagcgcgccggtaaactcgacgcg ctgctgctcgtctga

DBGET integrated database retrieval system