Pseudomonas synxantha LBUM223: VO64_3688 Help Entry VO64_3688         CDS       T03769                                  Name (GenBank) DNA-binding protein Fis   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism pfb  Pseudomonas synxantha LBUM223 Brite KEGG Orthology (KO) [BR:pfb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pfb03000]     VO64_3688    03036 Chromosome and associated proteins [BR:pfb03036]     VO64_3688    03400 DNA repair and recombination proteins [BR:pfb03400]     VO64_3688 Transcription factors [BR:pfb03000]  Prokaryotic type   Helix-turn-helix    Other families     VO64_3688 Chromosome and associated proteins [BR:pfb03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     VO64_3688 DNA repair and recombination proteins [BR:pfb03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       VO64_3688 SSDB OrthologParalogGFIT Motif Pfam:  HTH_8 Fis_N DUF6507 Xre-like-HTH DUF134 Motif Other DBs NCBI-ProteinID:  AKA84234 LinkDB All DBs Position complement(4161231..4161509) Genome browser AA seq 92 aa AA seqDB search MSDNVNLKQHLNTPSEEGQTLRGSVEKALHNYFAHLEGASVTDVYNLVLSEVEAPLLESV MNYVKGNQTKASELLGLNRGTLRKKLKQYDLL NT seq 279 nt NT seq  +upstreamnt  +downstreamnt gtgagcgacaacgtcaatttgaaacagcacctcaatacgccgagcgaagaaggccagacc cttcgcgggagtgtcgagaaggcgctgcacaattatttcgcccaccttgagggcgcttcc gtcacggacgtgtacaacctggtgctctccgaagtcgaggcgcccttgctcgaaagcgtg atgaactacgtcaagggcaaccagaccaaagccagtgagctgctgggcctcaaccgtggg accttgcgcaaaaagctcaagcagtacgatttgctgtaa

DBGET integrated database retrieval system