KEGG   Pseudomonas fluorescens A506: PflA506_0252
Entry
PflA506_0252      CDS       T02114                                 
Symbol
tauD
Name
(GenBank) alpha-ketoglutarate-dependent taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc00430  Taurine and hypotaurine metabolism
pfc00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:pfc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    PflA506_0252 (tauD)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    PflA506_0252 (tauD)
Enzymes [BR:pfc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     PflA506_0252 (tauD)
SSDB
Motif
Pfam: TauD NUFIP1
Other DBs
NCBI-ProteinID: AFJ56621
LinkDB
Position
complement(295646..296482)
AA seq 278 aa
MSSLTITPLSTALGAQISGVDITQPLNPEQRDAIEQALLDYSVLFFRDQPITPQQQARFA
ANFGDLHIHPIYPNVPEQPQVLILDTAVTDVRDNAVWHTDVTFLPTPALGAVLSAKLLPA
FGGDTLWASGIAAYEALSEPLKRMLDGLTATHDFTKSFPLERFGNTAEDLARWEATRKKN
PPLSHPVVRTHPVSGRKSLFVSDGFTTRINELEPAESEAILKLLFAHATRPEFTIRWRWQ
ENDVAFWDNRVTQHYAVDDYRPQRRVMHRATILGDVPF
NT seq 837 nt   +upstreamnt  +downstreamnt
atgagcagcctgaccattaccccattaagcaccgccctgggcgcccagatcagtggcgtc
gacatcactcagccgctgaaccctgaacagcgcgacgccattgaacaggcgttgctcgac
tattcggtgctgttcttccgtgaccagccgatcaccccgcagcaacaggcacgcttcgcg
gccaattttggcgacctgcacatccacccgatctatcccaacgtgccggaacagccgcaa
gtgctgatcctcgacaccgcggtcaccgacgtgcgtgacaacgccgtttggcacaccgac
gtgaccttcctgcccacgccggccctgggcgcggtgctcagtgccaagctgctgccggcg
tttggcggcgatacattgtgggccagtggcattgcggcgtatgaggcactgtccgagccg
ttaaagcgcatgctcgatggcctcaccgccacacacgatttcaccaagtcgttcccgctg
gagcgctttggcaacaccgccgaagaccttgcgcgctgggaagcgacccgcaagaaaaac
ccgccgctatcgcacccagtcgtgcgcacacatccggtgagtgggcgtaaatcgctgttc
gtcagcgacggattcaccacccgaatcaatgaactggaaccggccgaaagcgaggccatt
ctcaagctgctgttcgcccacgccacccgcccggaattcaccatccgctggcgctggcag
gagaatgatgtggcgttctgggataaccgcgtcacccagcattacgccgtggatgactac
cggccgcagcggcgggtgatgcaccgggcgacgattcttggggatgtgccgttctaa

DBGET integrated database retrieval system