Pseudomonas fluorescens A506: PflA506_0428 Help Entry PflA506_0428      CDS       T02114                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism pfc  Pseudomonas fluorescens A506 Pathway pfc00998   Biosynthesis of various antibiotics pfc01100   Metabolic pathways pfc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PflA506_0428    00074 Mycolic acid biosynthesis     PflA506_0428   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PflA506_0428 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AFJ55930 LinkDB All DBs Position complement(488167..488436) Genome browser AA seq 89 aa AA seqDB search MSDQHRLEHDIKTLIIEALGLEDISVDDIGSEQTLFGEGLGLDSVDALELGLAIQKKYGI KIDADAKDTRNHFTNVASLAAFVTARQAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcgaccaacaccgccttgagcacgacataaagacgctgatcatcgaggccctgggc ctggaagacatcagcgtcgacgacattggcagcgagcagacgctgtttggcgaaggcctg ggcctggattcggtcgacgccctggaattgggcctggcgattcagaaaaaatacggcatc aaaatcgatgccgacgccaaggacacccgcaatcacttcaccaacgtggccagccttgcg gcattcgtcacggcccgacaggcagcttga

DBGET integrated database retrieval system