Pseudomonas fluorescens A506: PflA506_4041 Help Entry PflA506_4041      CDS       T02114                                  Name (GenBank) anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism pfc  Pseudomonas fluorescens A506 Pathway pfc02020   Two-component system pfc02025   Biofilm formation - Pseudomonas aeruginosa pfc02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pfc00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     PflA506_4041  09140 Cellular Processes   09145 Cellular community - prokaryotes    02025 Biofilm formation - Pseudomonas aeruginosa     PflA506_4041   09142 Cell motility    02040 Flagellar assembly     PflA506_4041  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pfc02035]     PflA506_4041 Bacterial motility proteins [BR:pfc02035]  Flagellar system   Flagellar assembly proteins    Others     PflA506_4041 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  AFJ57355 LinkDB All DBs Position 4471267..4471590 Genome browser AA seq 107 aa AA seqDB search MVIDFSRLNNTPALPGNTHTGGAKDSVEAKPQPLPAKAEQAAASQSGESVHLSNEAQQLQ KVTDSLRDQPVVNKARVAELKQAIADGSYKVDSNRVASKLLNFEAER NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggtcattgatttcagtcgtttgaataacaccccggccttgcccggcaatacgcacacc ggcggtgccaaggacagcgtagaagccaagccgcagcccttgcctgccaaagcagagcag gccgccgccagccagagtggggaatcggtacacctgagcaatgaggctcaacagttgcaa aaggtcactgactcgctgcgcgatcaacccgtcgtcaataaagcccgcgtggccgagttg aaacaggctatcgccgatggcagctataaagtcgacagcaaccgtgtagccagcaagctg ctcaacttcgaagccgagcgctag

DBGET integrated database retrieval system