Plasmodium falciparum Dd2: PFDG_01468 Help Entry PFDG_01468        CDS       T01051                                  Name (GenBank) hypothetical protein   KO K10418   dynein light chain LC8-type Organism pfd  Plasmodium falciparum Dd2 Pathway pfd04814   Motor proteins Brite KEGG Orthology (KO) [BR:pfd00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     PFDG_01468  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pfd03037]     PFDG_01468    04812 Cytoskeleton proteins [BR:pfd04812]     PFDG_01468 Cilium and associated proteins [BR:pfd03037]  Motile cilia and associated proteins   Dynein arm    PFDG_01468 Cytoskeleton proteins [BR:pfd04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      PFDG_01468 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-ProteinID:  KOB85915 UniProt:  A0A0L7M080 LinkDB All DBs AA seq 97 aa AA seqDB search MEEPKCDILYEHMNYENKIKLINIAKEIYININNNKINSWRNATIALRDKIKEVLDFNEK GWHIIIGSKFGFFCTHEIYHALHFKLDHIEFLIFKHG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggaagaacctaaatgtgatattttatatgaacatatgaattatgaaaataaaataaaa ttaattaacatagcaaaggaaatatatataaatataaataataataaaataaattcttgg agaaatgcaactatagctttaagagataaaataaaggaagttttagattttaacgaaaaa ggttggcatataataattggatccaaatttggatttttttgtactcatgaaatttatcat gctttgcattttaaattagatcatatagagttccttatttttaaacatggataa

DBGET integrated database retrieval system