Plasmodium falciparum Dd2: PFDG_01492 Help Entry PFDG_01492        CDS       T01051                                  Name (GenBank) hypothetical protein   KO K10418   dynein light chain LC8-type Organism pfd  Plasmodium falciparum Dd2 Pathway pfd04145   Phagocytosis pfd04517   IgSF CAM signaling pfd04814   Motor proteins Brite KEGG Orthology (KO) [BR:pfd00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     PFDG_01492  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     PFDG_01492   09142 Cell motility    04814 Motor proteins     PFDG_01492  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pfd03037]     PFDG_01492    04812 Cytoskeleton proteins [BR:pfd04812]     PFDG_01492 Cilium and associated proteins [BR:pfd03037]  Motile cilia and associated proteins   Dynein arm    PFDG_01492 Cytoskeleton proteins [BR:pfd04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      PFDG_01492 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light CotJB Motif Other DBs NCBI-ProteinID:  KOB86020 LinkDB All DBs AA seq 93 aa AA seqDB search MADRKSNKNAVVKNVDMTEEMQIDAIDCANQALQKYNVEKDIAAHIKKEFDRKYDPTWHC VVGRNFGSYVTHETKNFIYFYIGQVAILLFKSG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggctgatagaaaatctaataaaaatgcagttgtaaaaaatgtagatatgacagaagaa atgcaaattgatgctattgattgtgctaatcaggccttacaaaaatataacgtcgaaaaa gatattgctgcacatattaaaaaagaatttgatagaaaatatgacccaacttggcactgt gttgtaggaagaaattttggatcttatgttactcacgaaaccaaaaattttatatatttt tatattggacaagtagctatattattatttaaatcgggatga

DBGET integrated database retrieval system