Plasmodium falciparum Dd2: PFDG_03480 Help Entry PFDG_03480        CDS       T01051                                  Name (GenBank) hypothetical protein   KO K08336   ubiquitin-like protein ATG12 Organism pfd  Plasmodium falciparum Dd2 Pathway pfd04136   Autophagy - other Brite KEGG Orthology (KO) [BR:pfd00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     PFDG_03480  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pfd04131]     PFDG_03480    04121 Ubiquitin system [BR:pfd04121]     PFDG_03480    03029 Mitochondrial biogenesis [BR:pfd03029]     PFDG_03480 Membrane trafficking [BR:pfd04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     PFDG_03480 Ubiquitin system [BR:pfd04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    PFDG_03480 Mitochondrial biogenesis [BR:pfd03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     PFDG_03480 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 Motif Other DBs NCBI-ProteinID:  KOB88737 UniProt:  A0A0L7M793 LinkDB All DBs AA seq 70 aa AA seqDB search MKKNKVLINGNETFSSLLIFLKRIFNKNDNIYLYINNNIKPNLDDYIYDLYDLYQISGSL NISYSFTPAY NT seq 213 nt NT seq  +upstreamnt  +downstreamnt ttgaaaaaaaataaagtgctcattaatggaaatgaaactttttcttccttattaatattc ctcaaaagaatattcaacaaaaatgataatatatatttatatatcaacaataatataaaa ccgaaccttgacgattatatttatgacctatacgatttgtatcaaatatcagggagttta aatatatcttatagttttacgccagcatattaa

DBGET integrated database retrieval system