KEGG   Paludibaculum fermentans: IRI77_00085
Entry
IRI77_00085       CDS       T06895                                 
Name
(GenBank) ATP-dependent Clp protease adaptor ClpS
  KO
K06891  ATP-dependent Clp protease adaptor protein ClpS
Organism
pfer  Paludibaculum fermentans
Brite
KEGG Orthology (KO) [BR:pfer00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    IRI77_00085
SSDB
Motif
Pfam: ClpS
Other DBs
NCBI-ProteinID: QOY88401
UniProt: A0A7S7SLG4
LinkDB
Position
17390..17716
AA seq 108 aa
MAFAAPTPGTESSEQEKQDLVPLWNVVLLDDDDHTYDYVIEMLCRLFFKTVEEAYGNAVE
VDSTGRTIVMTCDKPAAEFARDQIHGYGADWRMPNCKGSMSAILEPVA
NT seq 327 nt   +upstreamnt  +downstreamnt
atggctttcgctgcgcccactccgggtacggagtcgagcgaacaagaaaaacaggatttg
gtccctctgtggaacgtcgtccttctggatgacgatgaccacacgtacgactacgtgatc
gagatgctttgccggctgttctttaagacagtggaagaagcttacgggaacgccgtcgaa
gtggattccaccggccggaccatcgtcatgacctgcgacaagccggctgccgagtttgcg
cgggatcagatccacggatacggcgccgactggcgcatgcccaactgcaagggctcgatg
tcggccatcctcgaaccggtcgcctga

DBGET integrated database retrieval system