Paludibaculum fermentans: IRI77_21975 Help Entry IRI77_21975       CDS       T06895                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pfer  Paludibaculum fermentans Pathway pfer01100   Metabolic pathways pfer01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfer00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IRI77_21975    00074 Mycolic acid biosynthesis     IRI77_21975   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IRI77_21975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QOY85490 UniProt:  A0A7S7NKT9 LinkDB All DBs Position complement(5586913..5587185) Genome browser AA seq 90 aa AA seqDB search MQETTSQRVIRVIAENQRIPVDTIQAESTFQELNIDSLDGLHILFALEEEFDIDIPDDAG KEFTSIQQAIAGVETLLARKQAAASASDPA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgcaggaaactaccagtcagcgcgtcatccgcgtcattgccgagaaccagcgcatcccg gtcgataccattcaggctgagagcacgtttcaggaactcaacatcgattccctggacgga ctccatatcctctttgccctggaggaggagttcgacatcgatatcccggatgatgccggc aaggagttcacctccatccagcaggccatcgctggcgtcgagacgctgttggcgcgcaag caggctgctgcttccgcatccgatccggcatga

DBGET integrated database retrieval system