Paludibaculum fermentans: IRI77_30725 Help Entry IRI77_30725       CDS       T06895                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pfer  Paludibaculum fermentans Pathway pfer02024   Quorum sensing pfer03018   RNA degradation Brite KEGG Orthology (KO) [BR:pfer00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     IRI77_30725  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     IRI77_30725  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pfer03019]     IRI77_30725    03036 Chromosome and associated proteins [BR:pfer03036]     IRI77_30725 Messenger RNA biogenesis [BR:pfer03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      IRI77_30725 Chromosome and associated proteins [BR:pfer03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     IRI77_30725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq_1 Hfq LSM KH_dom-like ISP3_C Motif Other DBs NCBI-ProteinID:  QOY87105 UniProt:  A0A7S7NP28 LinkDB All DBs Position 7753310..7753621 Genome browser AA seq 103 aa AA seqDB search MESPNRRLIRPPLAEPKERASSSARSSALQKKQAPPDTTNAENFYYVKQMQSKTPVVIVL QDGEELNGVLEWYDKNCLKLTRDEGPNLLVYKSYIKYIYKQEG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt ttggagtcccccaatcgccgactgattcgtccgcctttagctgaaccgaaagagagggca tcgagcagtgcgcgttcttccgccctccagaagaaacaggctccccccgacaccaccaac gccgagaacttctattacgtcaaacagatgcagtcgaagacccccgtggtcatcgtgctg caggacggggaagagctgaatggcgtgctcgagtggtatgacaagaactgcctcaagctg acgcgggacgaggggccgaatctgctcgtctataagtcgtacatcaagtacatctataag caggaagggtaa

DBGET integrated database retrieval system