Paludibaculum fermentans: IRI77_32140 Help Entry IRI77_32140       CDS       T06895                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pfer  Paludibaculum fermentans Pathway pfer00020   Citrate cycle (TCA cycle) pfer00720   Other carbon fixation pathways pfer01100   Metabolic pathways pfer01110   Biosynthesis of secondary metabolites pfer01120   Microbial metabolism in diverse environments pfer01200   Carbon metabolism pfer01210   2-Oxocarboxylic acid metabolism Module pfer_M00009   Citrate cycle (TCA cycle, Krebs cycle) pfer_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:pfer00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     IRI77_32140   09102 Energy metabolism    00720 Other carbon fixation pathways     IRI77_32140 Enzymes [BR:pfer01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      IRI77_32140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_2 Fer4_6 Fer4_16 Fer4_10 Fer4_4 Fer4_9 Fer4_15 Fer4_8 Fer4_13 Fer4_17 Fer4_22 Fer4_ETF_QO Fer4_18 Fer4_3 Motif Other DBs NCBI-ProteinID:  QOY87363 UniProt:  A0A7S7NPF0 LinkDB All DBs Position complement(8096004..8096246) Genome browser AA seq 80 aa AA seqDB search MPKGSVAVTAERCKGCGFCVEFCPTHVLELSNAFNAKGYHPPHMINAEKCSGCNLCGMYC PDFAIFGYRFPDAKSQKKEA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgccaaaaggctccgttgccgtcacggccgaacgctgtaaagggtgtggcttctgtgta gagttctgccccactcacgtgctggaactctcgaatgcctttaacgccaaaggctaccac ccgccgcacatgataaatgccgagaaatgctcgggttgcaacctgtgcggcatgtattgt ccagacttcgccatcttcggctaccggttcccggacgcgaagagccagaagaaggaagca tga

DBGET integrated database retrieval system