Pandoraea faecigallinarum: AB870_00845 Help Entry AB870_00845       CDS       T03972                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism pfg  Pandoraea faecigallinarum Brite KEGG Orthology (KO) [BR:pfg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pfg03032]     AB870_00845    03036 Chromosome and associated proteins [BR:pfg03036]     AB870_00845    03400 DNA repair and recombination proteins [BR:pfg03400]     AB870_00845 DNA replication proteins [BR:pfg03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AB870_00845 Chromosome and associated proteins [BR:pfg03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AB870_00845 DNA repair and recombination proteins [BR:pfg03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AB870_00845 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 2C_adapt Motif Other DBs NCBI-ProteinID:  AKM28989 UniProt:  A0A0H3WM77 LinkDB All DBs Position complement(2835246..2835518) Genome browser AA seq 90 aa AA seqDB search MNKTELIDHISEQADISKAASGRALDAFVGAVKKALKKGDDVTLVGFGTFFVNKRAARTG RNPRTGEAIKIKAAKVPKFRPGKDLKDNVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataagacggaactgatcgatcacatctcggaacaggcagacatttcgaaagctgcg tccggacgagcacttgacgcattcgtaggggcagtaaagaaagcgctgaagaagggtgac gatgtgacgctggttggctttgggactttcttcgtcaacaagcgcgccgcccgcacgggc cgcaatccgcgcactggcgaggccatcaagatcaaggcggccaaagttccgaaatttcgc cctggcaaagatctcaaagataatgtaaactaa

DBGET integrated database retrieval system