Pandoraea faecigallinarum: AB870_07100 Help Entry AB870_07100       CDS       T03972                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pfg  Pandoraea faecigallinarum Pathway pfg00998   Biosynthesis of various antibiotics pfg01100   Metabolic pathways pfg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AB870_07100    00074 Mycolic acid biosynthesis     AB870_07100   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AB870_07100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF5783 DUF1493 DUF1896 Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AKM29922 UniProt:  A0A0H3WPY5 LinkDB All DBs Position complement(4249490..4249729) Genome browser AA seq 79 aa AA seqDB search MDTIEQRVKKIVAEQLGVAEADVKNESSFVNDLGADSLDTVELVMALEEEFEIEIPDEDA EKITTVQQAIDFAQAQSKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggataccattgagcaacgcgtcaagaagatcgtcgcggaacaacttggcgtggcagaa gccgacgtcaagaacgaatccagctttgtgaacgatcttggcgctgactcgctcgacacg gttgagctggtgatggcactggaagaagagttcgagatcgagatcccggacgaagacgca gaaaagatcaccaccgtgcaacaagctatcgatttcgcccaggctcagtcgaaggcctga

DBGET integrated database retrieval system