Pandoraea faecigallinarum: AB870_10295 Help Entry AB870_10295       CDS       T03972                                  Name (GenBank) cytochrome C oxidase subunit IV   KO K02277   cytochrome c oxidase subunit IV [EC:7.1.1.9] Organism pfg  Pandoraea faecigallinarum Pathway pfg00190   Oxidative phosphorylation pfg01100   Metabolic pathways Module pfg_M00155   Cytochrome c oxidase, prokaryotes Brite KEGG Orthology (KO) [BR:pfg00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AB870_10295 Enzymes [BR:pfg01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.9  cytochrome-c oxidase      AB870_10295 SSDB OrthologParalogGFIT Motif Pfam:  COX4_pro Herpes_U15 MerC DUF3290 DUF5693 Motif Other DBs NCBI-ProteinID:  AKM32723 UniProt:  A0A0H3X183 LinkDB All DBs Position complement(4961517..4961789) Genome browser AA seq 90 aa AA seqDB search MKVWGLLFVLSTFSYLVDYANLQGYLRWGLILVLMVAKAGLIVAVFMHMRWERLALVYAI LIPPLALLVLMSLMASEADFTFVTRLAHFR NT seq 273 nt NT seq  +upstreamnt  +downstreamnt ctgaaggtgtgggggctgctgttcgtgctctcgaccttttcgtatctcgtcgactacgcg aatctgcaaggttatctgcgttggggactgattctcgtgctgatggtcgcgaaggcgggt ctgatcgtcgcggtattcatgcacatgcgatgggagcggctcgcgctcgtgtatgcgatt ctgatcccgccgttggcgctgctcgtgctgatgtcgttgatggcctcggaggccgacttc accttcgtcacgcggctcgcccatttccgatga

DBGET integrated database retrieval system