Pandoraea faecigallinarum: AB870_20435 Help Entry AB870_20435       CDS       T03972                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pfg  Pandoraea faecigallinarum Pathway pfg02024   Quorum sensing pfg03018   RNA degradation Brite KEGG Orthology (KO) [BR:pfg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     AB870_20435  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AB870_20435  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pfg03019]     AB870_20435    03036 Chromosome and associated proteins [BR:pfg03036]     AB870_20435 Messenger RNA biogenesis [BR:pfg03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      AB870_20435 Chromosome and associated proteins [BR:pfg03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AB870_20435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AKM31965 UniProt:  A0A0H3WWE5 LinkDB All DBs Position 1991250..1991486 Genome browser AA seq 78 aa AA seqDB search MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAI STVVPARPVNFHPEAEQS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaaagggcaacttctacaagacccgtttctgaacgccttgcgtaaggagcat gttcccgtctcgatctatctggtcaacggtatcaagctgcagggaaacatcgagtcgttc gaccagtatgtcgtcctgctgcgcaacacggtcacgcaaatggtttacaagcacgccatt tcgacggtcgttcctgcgcgtccggtgaatttccatccggaagccgagcagtcctga

DBGET integrated database retrieval system