KEGG   Plasmodium falciparum HB3: PFHG_01431
Entry
PFHG_01431        CDS       T01052                                 
Name
(Broad) hypothetical protein similar to pyrophosphate-dependent phosphofructokinase
  KO
K24182  6-phosphofructokinase [EC:2.7.1.11]
Organism
pfh  Plasmodium falciparum HB3
Pathway
pfh00010  Glycolysis / Gluconeogenesis
pfh00030  Pentose phosphate pathway
pfh00051  Fructose and mannose metabolism
pfh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFHG_01431
   00030 Pentose phosphate pathway
    PFHG_01431
   00051 Fructose and mannose metabolism
    PFHG_01431
Enzymes [BR:pfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PFHG_01431
SSDB
Motif
Pfam: PFK
LinkDB
AA seq 1418 aa
MDTKSGDKNAANKGGADGLVKTVSVLLRDNKCQFNIDENYDHNDKEKLECEVGKRDSGMI
NCLMEKLTSKKFLEEKESKNSFYLVDNENMKIKKLKEHGHSASLNDDLSPLQYERTKYIP
SLPKALASEYQILDENYGDEFINKNDYEDVKRFLKNLHNLPMLNVKDSNNNESFKGGNIL
KIGIILSGGPAPGGHNVISGIYDYAKRYNEQSQVIGFLGGIDGLYSKNYVTITDSMMNRF
RNLGGFNMLWSGRGKVKNKDDLIAIENIVAKLKLNGLVIIGGDGSNSNAALMAEYFAERQ
IPISIIGVPKTIDGDLKSEAIEISFGFDTATRTYSEIIGNLCTDVKTGHNVYHVVRVMGR
SASHVVLECALQTRPNVVLIGEEVEQLNLSLKDIVKNIVNIILKRKSLNKNYGVILLPEG
LIEFVPEMKILISELNVILKDGPFDASKLQKSKEVWDFLPPIIRDQLLMDRESTGYIQVG
KIATERLIIVLVESELAKLNDKNLNIQFMSHYLGYEGRCAIPSNFDCNYCYALGYNAALL
IDHKKTGYMSIIRNLEDSYTNWIPAAIPFLRIMHVIKDNTGNEFPAVKRYLVDLNSPLFN
VLKEVRSLWSLYDLYRSPGPIQFNGHLGNARCYTVKTPTKDNLLCQNADDLELIINLTNK
NMYENNGDNNHNISDDKARDGGSSPTSSAKKTKYNLSDDNNNNNNNNINNVSTNYNNTSD
GSTFGNTTLLNTAYNVNGDGMNTLNCQKSNTSDVLSSEPVNQGFYEQHASSYKSLGCMSE
LQTSRLYNKLELPELCSDLKAKVRAGKQYISNDPYTQKQILSNYPHMSYENKFQIQEIFH
DKYASPISFEIRIGIVFLSRQAPGAMNVLCGLYRRLKLLKGVCIAFYGLYGLLHNKYIII
DDDNIAKYVNQGGLELTGNSPEHSLFDKENRNKVCETVTKLQLNGLVMPGSNITITEAAL
LSEYFLEKKIPTSVVGIPLTGSNNLIHELIETCVGFDSSTKVYASLIGNVLTDAVSMPKY
WHFIRLMGRSPSHEVLECALQTHPNVVIISEEYGAADKTLWRVVQDIADVVCARADVGKN
YGTVLIPDALLMHLPHMKILLSEISDILNEASEKGQLLEARNDLVNLSGVDHGHLTSEWV
SKLTPWSLALLKTFPQFIIKELLQVDLRSMRFEQLETEQLLLQMVKEELQDRKQKGKYSG
SFMGLTHFFGYQGRSSLPSEFDCKLAYAYGHAASIVIESGLTGYIVSIRGLCGNVKDWKL
FAIPFISLMKILPKGQGSKYLKSASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMEDRF
CNPGPIQFEGNASNYYNRILFEEQSEYFEMLRYVECYANILKDTCRFGVSADYLKNVFVQ
LCGMLVLAYKPNDILSNMPYIGSIEDYYDWENQRKRMN
NT seq 4257 nt   +upstreamnt  +downstreamnt
atggataccaagagtggagataaaaatgctgcaaataagggaggagctgatgggcttgta
aagactgtgtcagtattactacgagataacaaatgtcagtttaatattgatgaaaattat
gatcataatgataaagagaaattagagtgtgaggtaggtaaacgtgatagtggtatgata
aattgtttgatggagaaattgacatctaagaaatttttagaagagaaagaaagtaaaaat
agtttttatttagtagataatgaaaatatgaaaataaaaaaattaaaagaacatggtcat
tcagcttcattaaatgatgatttaagtccattacaatatgaaagaacaaaatatatacca
agcttacccaaagctttagctagtgaatatcaaatattagatgaaaattatggagatgaa
tttataaataaaaatgattatgaagatgtaaagaggtttttaaaaaatttacataattta
ccaatgctaaatgttaaagatagtaataataatgaatcatttaaaggtggaaatatttta
aaaattggtattattttatcgggtggtccagctcctggtggtcataatgtaatatctggt
atttatgattatgctaaacgatataatgaacaatcacaagttattggatttcttggtggt
attgatggtttatatagtaaaaattatgttactataacagatagtatgatgaatcgattt
cgtaatttaggtggttttaatatgttatggtcaggtagaggaaaagtaaaaaataaagat
gatttgattgctatcgaaaatattgtagccaaattaaaattaaatggtttagttattatt
ggtggtgatggctcaaatagtaatgctgctttaatggctgaatattttgctgaaagacaa
attcctatatccattattggtgtacctaaaactattgatggtgatttaaaaagtgaggct
atagaaattagctttggttttgatactgctactagaacatactcagaaattattggaaat
ttatgtactgatgtaaaaactggtcataatgtataccatgttgttcgtgttatgggtaga
tcagcatcacatgttgttttagaatgtgctttacaaacaagaccaaatgttgttctaatt
ggtgaagaagttgaacaattgaatttgtcccttaaagatattgttaaaaatattgttaat
attatattgaaaagaaaatcattaaataaaaattatggtgttatcttattacctgaaggt
ttaattgaatttgtacctgagatgaaaatattaatttctgaattaaatgttatattaaaa
gatggtccatttgatgcttcgaaacttcaaaagtctaaagaagtttgggatttcttacca
cctattattagagatcaattgttaatggatagagaatcaactgggtatattcaagttgga
aaaatcgcaaccgaaagattaattattgtattagtagaatctgaactagccaaattaaat
gataaaaacctaaatatacaatttatgtcacattatctaggttatgaaggtagatgtgct
ataccatcaaattttgattgtaattattgttatgcattaggttacaacgctgcactttta
attgatcataaaaaaacaggatatatgtcgattattagaaacttggaagattcatatacc
aattggataccagctgcaattccatttttacgaattatgcatgtaattaaagataacaca
ggtaatgaattcccagctgttaaaagatatttagttgatttaaatagtccattatttaat
gtattaaaggaagtaaggagtttgtggtctctttatgatttatatagatctccaggacct
atccaatttaatggccatttaggtaatgcacgttgttatactgtaaagactccaacaaag
gataatttgttatgtcagaatgccgatgatttagagcttattataaatctaactaacaag
aatatgtatgaaaataatggggacaataatcataatatatctgacgataaagcaagggat
ggtggatcatcaccaacaagttctgctaagaaaacaaagtacaatctaagtgatgataat
aataataataataataataatatcaataatgtaagcactaattataataatacatcagat
ggatccacctttggtaatactaccttattaaatacagcctataatgtaaatggtgatgga
atgaatactttaaattgtcaaaaaagcaatacatctgatgttttgtcttcagaacctgta
aaccaaggattttatgaacaacatgcatctagttataaatcattaggttgtatgtccgaa
ttacaaacatctaggttgtataataaattagaattgcccgaattatgttctgatttgaaa
gcaaaggttagagcaggaaaacagtatatatccaatgatccatatacacaaaaacaaatc
ttatcaaattaccctcatatgtcttatgagaacaaatttcagatacaagaaatatttcat
gataaatatgctagtcccatttcttttgaaataagaattggtatagtatttttatcaaga
caggctccaggtgctatgaatgtgttatgtggtttatataggcgtttgaaattattaaaa
ggtgtttgtattgcattttacggattatatggattattacataataaatacattataata
gatgatgataatatagcaaaatacgtaaatcaaggaggtttagaattaactggcaattct
ccagagcattcattatttgataaagaaaatagaaataaagtatgtgagacagttacaaaa
ttacaattgaatggtttagttatgccaggatctaatataactattacagaagctgcttta
ttatcagaatactttttagaaaaaaaaatacctacatctgttgttggtataccattaaca
ggatctaataatttgatacatgaattaatagagacatgtgttggttttgatagtagtaca
aaagtatatgcatcattaataggtaatgtattgacagatgctgtaagtatgcctaagtat
tggcattttattcgtttaatgggaagatctccatcacatgaggttttagaatgtgcttta
caaacacatccaaatgtagttattatatcagaagaatatggagctgcagataaaacatta
tggagagttgttcaagatattgctgatgttgtatgtgcacgagctgatgttggaaaaaat
tatggtactgtattaattccagatgctttattgatgcacttaccacatatgaaaatatta
ttatctgaaataagtgatatattaaatgaggcatcagaaaaaggccaattattagaagca
agaaatgatttagtaaatttatctggtgtggatcatggtcacttaacatcagaatgggtt
tctaaattaacaccatggagtttagcattattaaagacattcccacaatttattataaaa
gaattattacaggtagatttgagatctatgcgttttgaacaattagaaactgaacaatta
ttattacaaatggttaaagaagaattacaagatagaaagcaaaaaggaaaatattcagga
agtttcatgggcttaacacacttttttggttatcaaggacgttcatcattaccatcagaa
tttgattgtaagttagcatatgcatatggacatgcagcatcaatagttattgaaagtggc
ttaacaggatatattgtatctataagaggattatgtggtaatgttaaagattggaaatta
tttgctataccattcatatcattaatgaaaatattaccaaaaggacaaggaagtaaatat
ttaaaaagtgcatctaaaggtgatttaccagtaattcctagtgcacctgtagatttgaat
ggaaaagcttatagaagcttaaaaattgctttacaaaaatggcaaatggaagatcgtttt
tgtaatcctggaccaatacaatttgaaggtaatgcatctaattattataataggatatta
tttgaagaacaatctgaatattttgaaatgttaagatatgttgaatgttatgcaaatatt
ttaaaagatacttgtcgttttggtgtctcagctgattatctgaaaaatgtatttgtacag
ttatgtggtatgttggtattagcatataagcctaatgatatcttatctaatatgccatat
attggaagtatagaagattattatgattgggaaaaccagagaaaaagaatgaactaa

DBGET integrated database retrieval system