Pyrococcus furiosus COM1: PFC_00315 Help Entry PFC_00315         CDS       T02183                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism pfi  Pyrococcus furiosus COM1 Pathway pfi03010   Ribosome Brite KEGG Orthology (KO) [BR:pfi00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     PFC_00315   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     PFC_00315  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:pfi03011]     PFC_00315    04121 Ubiquitin system [BR:pfi04121]     PFC_00315   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pfi04147]     PFC_00315 Ribosome [BR:pfi03011]  Ribosomal proteins   Eukaryotes    Small subunit     PFC_00315   Archaea     PFC_00315 Ubiquitin system [BR:pfi04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    PFC_00315 Exosome [BR:pfi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    PFC_00315   Exosomal proteins of colorectal cancer cells    PFC_00315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Cas12f1-like_TNB Zn_ribbon_NUD Zn_ribbon_IS1595 Zn_ribbon_Nudix Zn_ribbon_RPB9 GFA MqsA_antitoxin Zn_Ribbon_1 Motif Other DBs NCBI-ProteinID:  AFN03039 UniProt:  I6TUR2 LinkDB All DBs Position complement(61407..61559) Genome browser AA seq 50 aa AA seqDB search MGQKWKLYEIKDGKVIRKNKFCPRCGPGVFMADHGDRWACGKCGYTEWKK NT seq 153 nt NT seq  +upstreamnt  +downstreamnt atgggacagaagtggaagctctacgagattaaggatgggaaagttataagaaagaacaag ttctgcccgcgctgtggcccaggagtattcatggcagatcacggggataggtgggcctgt gggaagtgtggatatacagagtggaagaagtga

DBGET integrated database retrieval system