Pyrococcus furiosus COM1: PFC_09180 Help Entry PFC_09180         CDS       T02183                                  Name (GenBank) DNA/RNA-binding protein albA   KO K03622   DNA/RNA-binding protein Alba Organism pfi  Pyrococcus furiosus COM1 Brite KEGG Orthology (KO) [BR:pfi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pfi03036]     PFC_09180 Chromosome and associated proteins [BR:pfi03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     PFC_09180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Alba Rpp20 Motif Other DBs NCBI-ProteinID:  AFN04759 UniProt:  I6TZ21 LinkDB All DBs Position 1670370..1670651 Genome browser AA seq 93 aa AA seqDB search MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDTV DIKEIKIGTEELPTADGRTTNTSTIEIVLERKV NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggctgaggagcacgttgtttacattggaaagaagcctgttatgaactatgtcctagcc gtaataacccagttcaacgagggagcaaaggaggtctcaataaaggcccgtggtagggct attagcagagctgttgatgtagcagaaatcgtcagaaacaggttcctcaaggacaccgtt gacattaaggagattaagatcggtactgaggagcttccaactgcagacggtagaacaaca aacacttcaactattgagatcgttctagagagaaaggtctga

DBGET integrated database retrieval system