Pandoraea fibrosis: PI93_007835 Help Entry PI93_007835       CDS       T06385                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pfib  Pandoraea fibrosis Pathway pfib00998   Biosynthesis of various antibiotics pfib01100   Metabolic pathways pfib01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfib00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PI93_007835 (acpP)    00074 Mycolic acid biosynthesis     PI93_007835 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PI93_007835 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 N_formyltrans_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QHF12565 LinkDB All DBs Position 1752905..1753153 Genome browser AA seq 82 aa AA seqDB search MDNFEQRVKKIVAEQLGVNEADVKNESSFVNDLGADSLDTVELVMALEEEFGTEIPDEDA EKITTVQQAIDYVRAHSDQDKA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggataactttgagcaacgcgtcaagaagatcgtcgcggaacaacttggcgtgaacgaa gccgacgtcaagaacgaatccagctttgtgaacgatctcggcgctgactcgctcgacacg gttgagctggtgatggcattggaagaagaattcggcacggaaatcccggacgaagacgct gaaaagatcaccacggtgcaacaggccatcgattacgttcgggcccattcggatcaggat aaggcctaa

DBGET integrated database retrieval system