Pseudomonas fitomaticsae: KJY40_03185 Help Entry KJY40_03185       CDS       T08740                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pfit  Pseudomonas fitomaticsae Pathway pfit01100   Metabolic pathways pfit01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfit00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KJY40_03185    00074 Mycolic acid biosynthesis     KJY40_03185   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KJY40_03185 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding ACP_SdgA_C Decorin_bind Motif Other DBs NCBI-ProteinID:  UFQ00708 UniProt:  A0ABY3Q3J4 LinkDB All DBs Position complement(711125..711379) Genome browser AA seq 84 aa AA seqDB search MQTRDDIFNTLRDALVELFELDPARVSLESNLYQDLEIDSIDAVDLIDHIKRQTGKKIAA EEFKSVRTVSDVVEAVYRLVQPAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaactcgtgacgacatcttcaacaccctgcgcgatgccctggtcgagctgttcgaa ctggacccggcccgcgtgagcctggaatccaacctgtatcaggatctggaaatcgacagc atcgacgccgtcgacctgatcgatcacatcaagcgccagaccggcaagaaaatcgccgcc gaggaattcaagtcagtgcgcaccgtcagcgacgtggtcgaggcggtctaccgtctggtt caaccggccgcatga

DBGET integrated database retrieval system