Pseudomonas fitomaticsae: KJY40_09165
Help
Entry
KJY40_09165 CDS
T08740
Name
(GenBank) chemotaxis response regulator protein-glutamate methylesterase
KO
K03412
two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:
3.1.1.61
3.5.1.44
]
Organism
pfit
Pseudomonas fitomaticsae
Pathway
pfit02020
Two-component system
pfit02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
pfit00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
KJY40_09165
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
KJY40_09165
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
pfit02022
]
KJY40_09165
02035 Bacterial motility proteins [BR:
pfit02035
]
KJY40_09165
Enzymes [BR:
pfit01000
]
3. Hydrolases
3.1 Acting on ester bonds
3.1.1 Carboxylic-ester hydrolases
3.1.1.61 protein-glutamate methylesterase
KJY40_09165
3.5 Acting on carbon-nitrogen bonds, other than peptide bonds
3.5.1 In linear amides
3.5.1.44 protein-glutamine glutaminase
KJY40_09165
Two-component system [BR:
pfit02022
]
CheA family
CheA-CheYBV (chemotaxis)
KJY40_09165
Bacterial motility proteins [BR:
pfit02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
KJY40_09165
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CheB_methylest
Response_reg
XPC-binding
Ndc1_Nup
Motif
Other DBs
NCBI-ProteinID:
UFQ01846
UniProt:
A0ABY3Q6Y8
LinkDB
All DBs
Position
2035892..2037028
Genome browser
AA seq
378 aa
AA seq
DB search
MAVKVLVVDDSGFFRRRVSEILSADPSIQVVGTATNGKEAIDQALALKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDFLPKNFEDISRNPEKVKQ
LLCEKVHSISRSNRRFSAYSAPAPAAAPAPAPTPAAAPSSFGSHSAPARPAPAPAPTRAP
AASASSPAPKRKNYKLVAIGTSTGGPVALQRVLTQLPASFPAPIVLIQHMPAAFTKAFAE
RLDKLCRISVKEAEDGDILRPGLALLAPGGKQMMIDGRGAVKILPGDERLNYKPCVDITF
GSAAKSYSDKVLAVVLTGMGADGREGARLLKQGGSTVWAQDEASCVIYGMPMAIVKADLA
DAVYSLDDIGKHIVEACV
NT seq
1137 nt
NT seq
+upstream
nt +downstream
nt
atggcagtcaaagtcctggtggtggacgattcgggttttttccgccgccgcgtctcggaa
attctttcagcggatccgagcatccaggttgtcggcacggcaaccaacggtaaagaggcg
atcgatcaggccctggccctcaagccggacgtgatcaccatggactacgagatgccgatg
atggatggcatcacggccgtgcggcacatcatgcagcgctgcccgaccccggtgttgatg
ttctcctcgctgacgcacgaaggcgcccgggtgaccctggatgcgctggatgccggcgcg
gtggatttcctgccgaagaatttcgaagacatctcccgcaacccggagaaggtcaagcaa
ctgctgtgcgagaaggttcacagcatctcgcgcagcaaccgtcgtttcagtgcctacagt
gcgccggcgcctgccgctgcacctgcacctgcgccgactccggcagcagcgccgtcgagc
tttggcagccacagtgctccggcccgtccggcaccagcgcctgcaccgactcgcgcgcca
gcggccagcgcttcgtcgccggccccgaaacgcaaaaactacaagctcgtggcgattggt
acatcgaccggcggcccggtcgcactgcaacgggtcctgacccagttgccggcgagcttc
ccggcgccgatcgtgctgattcagcacatgccggcggcctttaccaaggccttcgccgaa
cgtctggacaagctgtgccgcatcagcgtcaaggaagccgaggatggcgacatcctgcgt
ccggggctggcgctgctggcaccgggtggcaagcagatgatgatcgacggccgtggcgcg
gtgaaaatcctgccgggtgacgagcgtctgaactacaagccgtgcgtggacatcactttc
ggttcagcggccaagtcctacagcgacaaagttctggcggtcgtgttgaccggcatgggc
gccgacggccgcgaaggtgcacgcctgctcaagcagggcggcagcacggtctgggctcag
gacgaagccagttgcgtgatctacggcatgccgatggccatcgtcaaagctgacctcgcc
gacgcggtgtacagcctggacgatatcggcaagcacatcgtcgaggcatgcgtctga
DBGET
integrated database retrieval system