Pseudomonas fitomaticsae: KJY40_15855
Help
Entry
KJY40_15855 CDS
T08740
Name
(GenBank) DMT family transporter
Organism
pfit
Pseudomonas fitomaticsae
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
EamA
SLC35F
TPT
PUNUT
Multi_Drug_Res
Motif
Other DBs
NCBI-ProteinID:
UFP97546
UniProt:
A0ABY3PUK9
LinkDB
All DBs
Position
complement(3559513..3560460)
Genome browser
AA seq
315 aa
AA seq
DB search
MSCHEPDRPATSDMPVYLNLALVTMIWGGTWVAGRFLAGSLSPVFAASLRFLLASVALVV
CLRLARIRLARPTPRQWLQLTLLGFFGIFFYNLCFFYGLQYINASRASLIVALNPAVIGL
ASWLLFKERLSRLKVIGIAICIGGAGVVIVSRNPQLLSETPDAWIGDLLILGCVLSWGVY
SLFSRSLNQSIGPVQTVTFSILLGTLMLWALALSRGEVDVAALAAIGPRQWLSLAYLGLL
GSALAYIGYYDGIRKIGATRSGVFIALNPLTAVLAGAILLGEQLTLAMCLGGVLILAGIW
LCNKPLAPAGKKRIL
NT seq
948 nt
NT seq
+upstream
nt +downstream
nt
atgagttgtcatgaacctgatcgtccggccacctcggacatgcccgtctatttgaacctg
gctctggtcacgatgatctggggtggaacgtgggtggccgggcgttttttggccggcagc
ctgagcccggtgtttgccgccagcctgcggtttctgctggccagtgtggcgctggtcgtg
tgtttaaggctcgctcgaatccggttggcgcggcccacgccccggcaatggctgcaactg
acgttgctggggttcttcgggatcttcttctacaacctgtgcttcttttacgggttgcaa
tacatcaacgcttcccgagcctcgttgatcgtggctctgaacccggcggtcattggtctg
gcgtcatggctgctgttcaaggagcggctgagccggctgaaggtgatcggcatcgcaatc
tgcatcggcggggcgggtgtggtcatcgtcagtcgcaatccgcaactactgagcgaaacg
ccggacgcgtggattggcgatctgctgatcctcggctgcgttttgagctggggcgtctat
tcgctgttttcccgcagcctcaaccagagcatcggcccggtgcagaccgtgaccttttca
attctgctgggcaccctgatgttgtgggcgctggccctgagccgaggcgaagtggacgtt
gcagcgctggccgcgattggcccgcgccaatggctgagcctggcctatctgggcctgctc
ggctcggcgctggcctacatcggttactacgatggcatccgcaagatcggcgccacgcgc
tccggcgtgttcattgcgctcaatccgctgaccgccgtgctggccggtgcaatcctgctg
ggcgaacagctgacgctggccatgtgcctgggcggcgtgctgattctggcgggcatctgg
ctgtgcaacaaaccccttgcaccggccggaaaaaagcggattttatag
DBGET
integrated database retrieval system