Pseudomonas fitomaticsae: KJY40_21700 Help Entry KJY40_21700       CDS       T08740                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pfit  Pseudomonas fitomaticsae Pathway pfit01100   Metabolic pathways pfit01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfit00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KJY40_21700 (acpP)    00074 Mycolic acid biosynthesis     KJY40_21700 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KJY40_21700 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  UFP98636 UniProt:  A0ABY3PXE6 LinkDB All DBs Position complement(4822821..4823057) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgccgagcaactgggtgttaaagaa gaagaagtggtcaacaccgcttccttcgtagaagacctgggtgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagct gagaagatcactactgtacaagctgcaatcgactacgttactagccaccaggcgtaa

DBGET integrated database retrieval system