Pseudocercospora fijiensis: MYCFIDRAFT_45275 Help Entry MYCFIDRAFT_45275  CDS       T03109                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism pfj  Pseudocercospora fijiensis Pathway pfj03060   Protein export pfj04141   Protein processing in endoplasmic reticulum pfj04145   Phagosome Brite KEGG Orthology (KO) [BR:pfj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     MYCFIDRAFT_45275    04141 Protein processing in endoplasmic reticulum     MYCFIDRAFT_45275  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     MYCFIDRAFT_45275  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pfj04131]     MYCFIDRAFT_45275   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pfj02044]     MYCFIDRAFT_45275 Membrane trafficking [BR:pfj04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     MYCFIDRAFT_45275 Secretion system [BR:pfj02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    MYCFIDRAFT_45275 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE SAM_NCD1 Motif Other DBs NCBI-GeneID:  19339633 NCBI-ProteinID:  XP_007922511 JGI:  45275 UniProt:  M3BAU9 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search MDQAKELLEMPREFVKDGRQFLTRCSKPDKREFLRISQAVGMGFLIMGVIGYIVKLIHIP VNNILVGGA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggatcaagcaaaggagctccttgagatgcctcgagagttcgtcaaggatggccgacaa ttcttgacacgatgcagcaagccggacaagagggaattcctacgcatttcgcaagcagtg ggtatgggtttcctgatcatgggtgttatcggttatattgtgaagctgattcacattccc gtcaacaacatccttgtgggcggcgcgtag

DBGET integrated database retrieval system