Pseudomonas frederiksbergensis: PFAS1_02100 Help Entry PFAS1_02100       CDS       T04786                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism pfk  Pseudomonas frederiksbergensis Brite KEGG Orthology (KO) [BR:pfk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pfk03032]     PFAS1_02100    03036 Chromosome and associated proteins [BR:pfk03036]     PFAS1_02100    03400 DNA repair and recombination proteins [BR:pfk03400]     PFAS1_02100 DNA replication proteins [BR:pfk03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PFAS1_02100 Chromosome and associated proteins [BR:pfk03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PFAS1_02100 DNA repair and recombination proteins [BR:pfk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PFAS1_02100 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  APV38189 UniProt:  A0A1J0ER89 LinkDB All DBs Position complement(416783..417055) Genome browser AA seq 90 aa AA seqDB search MNKSELIDAIAASADIPKAAAGRALDAVIESVTGALKAGDSVVLVGFGTFSVTDRPARIG RNPQTGKTLEIAAAKKPGFKAGKALKEAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaagtcggaactgattgatgctatcgctgcatccgctgatatcccgaaagctgct gctggccgtgcgctggacgctgtaatcgaatccgtcactggcgctctcaaggctggcgac tctgttgttctggttggtttcggtactttctccgttaccgatcgtccagctcgcattggt cgtaacccacagaccggtaagacgctggaaatcgcagcagccaaaaaaccaggtttcaaa gccggtaaagcactgaaagaagctgtcaactaa

DBGET integrated database retrieval system