Pseudomonas protegens Pf-5: PFL_1197 Help Entry PFL_1197          CDS       T00249                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism pfl  Pseudomonas protegens Pf-5 Brite KEGG Orthology (KO) [BR:pfl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pfl03036]     PFL_1197 (ftsB) Chromosome and associated proteins [BR:pfl03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PFL_1197 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC NRBF2 ACCA_BT YabA HALZ XRCC4_CC Motif Other DBs NCBI-ProteinID:  AAY90484 UniProt:  Q4KHF5 LinkDB All DBs Position 1373060..1373338 Genome browser AA seq 92 aa AA seqDB search MRSPNWLFLVLLLLLAGLQYRLWVGNGSLAQVADLTQQIADQHAENERLLERNRVLDAEV MELKKGMETVEERARHELGMVKEGETLYQLAQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtcccaattggttgttcctggtcttgctcttgctgctggctggcttgcagtac cgcctgtgggtggggaacggcagcttggcccaggttgctgacctgactcagcagattgcc gaccagcacgctgaaaacgagcgtttgctggaacgaaatcgcgtactcgatgcggaagtc atggagctgaaaaaaggcatggagaccgtggaagaacgggctcgccatgagttgggtatg gtcaaggagggtgaaaccctctaccagttggcccaatga

DBGET integrated database retrieval system